PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 473654
Common NameARALYDRAFT_473654
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARF
Protein Properties Length: 602aa    MW: 68103.6 Da    PI: 6.6744
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
473654genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.52.6e-23127228199
             EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
             f kvlt sd++++g +++p+k a e+     ++++   ++l   d++g++W++k++yr++++r++lt+GW+ F  +++L +gD++vF   + +++el+v+++r
  473654 127 FTKVLTASDTSAHGGFSVPRKLAIEClppldMSQPLPAQELLTIDLHGNQWRFKHSYRGTPRRHLLTTGWNAFITSKKLVAGDVIVFL--RGETGELRVGIRR 227
             89****************************9666666679999*********************************************..449999*****99 PP

             S CS
      B3  99 k 99 
             +
  473654 228 A 228
             6 PP

2Auxin_resp91.31.6e-30253332183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a ha++++++F vvY+Pr+  s+F+v+++k+++a+++k+ vG+Rf  +fe++d+serr+ Gt++gv d++p +W+ S+WrsLk
      473654 253 AKHAFDNQCMFIVVYKPRS--SQFIVNYDKFLDAMNNKFNVGSRFTKRFEEDDFSERRYFGTIIGVIDFSP-HWKCSEWRSLK 332
                 6899**************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.1E-36117240IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.31E-31124249IPR015300DNA-binding pseudobarrel domain
CDDcd100171.16E-21126227No hitNo description
PROSITE profilePS5086313.437127229IPR003340B3 DNA binding domain
SMARTSM010195.4E-21127229IPR003340B3 DNA binding domain
PfamPF023621.5E-20127228IPR003340B3 DNA binding domain
PfamPF065071.9E-26253332IPR010525Auxin response factor
PfamPF023094.3E-5508550IPR033389AUX/IAA domain
SuperFamilySSF542771.7E-10511590No hitNo description
PROSITE profilePS5174523.109514601IPR000270PB1 domain
PfamPF023094.0E-5555594IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 602 aa     Download sequence    Send to blast
MESGNVVNAQ PELSGITVDG SKRYMYEQLW KLCAGPLCDI PKIGEKVYYF PQGHIELVEA  60
STGEKLNELQ PIVDLPSKLQ CRVITIQLKV ERNSDETYAE ITLMPYTTQV VIPTQNENQF  120
RPLVNSFTKV LTASDTSAHG GFSVPRKLAI ECLPPLDMSQ PLPAQELLTI DLHGNQWRFK  180
HSYRGTPRRH LLTTGWNAFI TSKKLVAGDV IVFLRGETGE LRVGIRRAGY QQGNIPSSII  240
SIESMRHGVI ASAKHAFDNQ CMFIVVYKPR SSQFIVNYDK FLDAMNNKFN VGSRFTKRFE  300
EDDFSERRYF GTIIGVIDFS PHWKCSEWRS LKDEFASFPR PDKVSPWEIE YSTPSSNVLR  360
LSMLKNKCSR EFNEIGSSSS HLLPPILTQG QEIGQPSMTS PMNVPLSYRD AIEDNSTPSR  420
LLMSYSVQTM SRLNYNNDQM VTPIIEGNIT NNGGASCRVF GVSLATPPVI KDPIEQMDSY  480
PNSEISKLSQ EKKFGLGQMR SPREIQSKQL SSTRTCTKVQ MHGVALGRAL DLSVLNGYDQ  540
LILELEKLFD LKGQLQNRNQ WEIAFKDNEE DEMLVGDDPW PEFCNMVKKI IIYSNEEVKN  600
F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-11713501353Auxin response factor 1
4ldw_A1e-11713501353Auxin response factor 1
4ldw_B1e-11713501353Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6697960.0AY669796.1 Arabidopsis thaliana clone C105354 ARF22 (At1g34390) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002893855.10.0hypothetical protein ARALYDRAFT_473654
SwissprotQ9LQE80.0ARFN_ARATH; Putative auxin response factor 14
TrEMBLD7KL380.0D7KL38_ARALL; Auxin response factor
STRINGfgenesh2_kg.1__3608__AT1G35540.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12276731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G35540.10.0auxin response factor 14